(data stored in ACNUC7421 zone)

EMBL: CP000462.PE14

CP000462.PE14        Location/Qualifiers
FT   CDS             complement(13269..15857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0014"
FT                   /product="sensory kinase in two-component regulatory system
FT                   wtih KdpE"
FT                   /note="regulates high-affinity potassium transport system;
FT                   identified by match to protein family HMM PF00512; match to
FT                   protein family HMM PF02518; match to protein family HMM
FT                   PF02702"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36570"
FT                   /db_xref="GOA:A0KED2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED2"
FT                   /protein_id="ABK36570.1"
FT                   /translation="MRDEVRADALLASLEQEHRGKLKVFLGAAPGVGKTYAMLQAVREQ
FT                   AKEGVDILIGVVETHGRQETLALLDKLAIQPRKLHLHRQQRLEEMDLDGLLARKPAIAV
FT                   VDELAHSNAPGSRHEKRWQDVEELLGAGIDVYTTLNVQHLESLNDLVWQLTGVRVKETL
FT                   PDQVLLEADSLVLIDLPPKELLGRLKEGKVYVPHQAKAALQSFFSLNNLTALRELAMQT
FT                   AASHVEGDLQLQWQAAGKTTLPLRGKLMVCLGDQHGAALVRYGHRFAQRRQLPWLVVHI
FT                   DSKGQRSVELEQALALASQLGAKVLTLSSPAVADTLLETAEQQQVSQLLLGKPHKAPWR
FT                   RSLVQHLLKQAQGLEITLVDTEKRKPSLGLKPLHPKDIRQSLLAVAIMGTTSAAVWGLS
FT                   HWLPPASLPMLFVLGVLATALTTSLMPAILAAVLGFVGHNLLFTAPYFSLSVASHSDLL
FT                   TLFVLLIVGITAGRLASRQRQQLIGLRETQQLGNALLSLSQGLATASSPEEVLRQGSQA
FT                   ISLALGQPVFALDQHYQHRAGSTQHKPGQTDKAAIDWCLAQKQSAGAHTATLNAAEAQY
FT                   HHLSDELVLGIVLANPLASSAEHQLQALLTDIRAALARIDLNERLADSQLQAETDRMRA
FT                   ALLSSVSHDLKTPLATIMGAGSTLLEYGDRISSEDRSELLHSVQDEARRLHSYVQNLLD
FT                   MTRIGSPDFQLKRDWVDLADLVENARRRLDSSWRQHKLLVHFDQQIPRLYVHGALIEQV
FT                   LVNILDNASRYSPAGTPIEFKVMLADPDLILDIIDIGVGIAESDRDKIFNLFYTQPVGD
FT                   CGSRGTGLGLAISRAMIEAHGGRIWAFSGPNGNGTCMRISLPLALNAAAA"
     MRDEVRADAL LASLEQEHRG KLKVFLGAAP GVGKTYAMLQ AVREQAKEGV DILIGVVETH        60
     GRQETLALLD KLAIQPRKLH LHRQQRLEEM DLDGLLARKP AIAVVDELAH SNAPGSRHEK       120
     RWQDVEELLG AGIDVYTTLN VQHLESLNDL VWQLTGVRVK ETLPDQVLLE ADSLVLIDLP       180
     PKELLGRLKE GKVYVPHQAK AALQSFFSLN NLTALRELAM QTAASHVEGD LQLQWQAAGK       240
     TTLPLRGKLM VCLGDQHGAA LVRYGHRFAQ RRQLPWLVVH IDSKGQRSVE LEQALALASQ       300
     LGAKVLTLSS PAVADTLLET AEQQQVSQLL LGKPHKAPWR RSLVQHLLKQ AQGLEITLVD       360
     TEKRKPSLGL KPLHPKDIRQ SLLAVAIMGT TSAAVWGLSH WLPPASLPML FVLGVLATAL       420
     TTSLMPAILA AVLGFVGHNL LFTAPYFSLS VASHSDLLTL FVLLIVGITA GRLASRQRQQ       480
     LIGLRETQQL GNALLSLSQG LATASSPEEV LRQGSQAISL ALGQPVFALD QHYQHRAGST       540
     QHKPGQTDKA AIDWCLAQKQ SAGAHTATLN AAEAQYHHLS DELVLGIVLA NPLASSAEHQ       600
     LQALLTDIRA ALARIDLNER LADSQLQAET DRMRAALLSS VSHDLKTPLA TIMGAGSTLL       660
     EYGDRISSED RSELLHSVQD EARRLHSYVQ NLLDMTRIGS PDFQLKRDWV DLADLVENAR       720
     RRLDSSWRQH KLLVHFDQQI PRLYVHGALI EQVLVNILDN ASRYSPAGTP IEFKVMLADP       780
     DLILDIIDIG VGIAESDRDK IFNLFYTQPV GDCGSRGTGL GLAISRAMIE AHGGRIWAFS       840
     GPNGNGTCMR ISLPLALNAA AA                                                862
//

If you have problems or comments...

PBIL Back to PBIL home page