(data stored in ACNUC7421 zone)

EMBL: CP000462.PE143

CP000462.PE143       Location/Qualifiers
FT   CDS             complement(177635..178471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0156"
FT                   /product="small-conductance mechanosensitive channel"
FT                   /note="identified by match to protein family HMM PF00924;
FT                   match to protein family HMM PF05552"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37732"
FT                   /db_xref="GOA:A0KEM4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEM4"
FT                   /protein_id="ABK37732.1"
FT                   /translation="MEPEIITEAQTWLVNNQGLLIEYAVNIAAALITLLVGYIAANLIS
FT                   SAVVKVMQARKLDTTVTHFVGSILKYAILVFVVIAALGRVGVQTASFVAIIGAAGLAIG
FT                   LALQGSLSNFAAGFLLIIFRPIKAGEFIEVAGTNGVVQSVQLFTTTLTSGDNKMVVVPN
FT                   SAILNGTIVNYSRMDTRRVDMTFGIGYGSDLRKAKQILERLVSEEPRILKEPAATIAVA
FT                   ALADSSVNIVVRPWVKTGDYWGVWFDFHEKVKLTFDAEGIEIPFPQMVMHMQKPQA"
     MEPEIITEAQ TWLVNNQGLL IEYAVNIAAA LITLLVGYIA ANLISSAVVK VMQARKLDTT        60
     VTHFVGSILK YAILVFVVIA ALGRVGVQTA SFVAIIGAAG LAIGLALQGS LSNFAAGFLL       120
     IIFRPIKAGE FIEVAGTNGV VQSVQLFTTT LTSGDNKMVV VPNSAILNGT IVNYSRMDTR       180
     RVDMTFGIGY GSDLRKAKQI LERLVSEEPR ILKEPAATIA VAALADSSVN IVVRPWVKTG       240
     DYWGVWFDFH EKVKLTFDAE GIEIPFPQMV MHMQKPQA                               278
//

If you have problems or comments...

PBIL Back to PBIL home page