(data stored in ACNUC7421 zone)

EMBL: CP000462.PE145

CP000462.PE145       Location/Qualifiers
FT   CDS             complement(179324..179782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0158"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /EC_number="3.6.1.23"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR00576"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39267"
FT                   /db_xref="GOA:A0KEM6"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEM6"
FT                   /protein_id="ABK39267.1"
FT                   /translation="MTTQIELKILDARIGTEYPLPAYATPGSAGMDLRALLDAPLTLAP
FT                   GDTTLVPTGLAIHIQDPGLCATILPRSGLGHKHGIVLGNLVGLIDSDYQGQLMVSVWNR
FT                   GNDNFTMQPGERIAQLVIMPVVQASFQLVDEFNQSERGEGGFGSSGRQ"
     MTTQIELKIL DARIGTEYPL PAYATPGSAG MDLRALLDAP LTLAPGDTTL VPTGLAIHIQ        60
     DPGLCATILP RSGLGHKHGI VLGNLVGLID SDYQGQLMVS VWNRGNDNFT MQPGERIAQL       120
     VIMPVVQASF QLVDEFNQSE RGEGGFGSSG RQ                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page