(data stored in ACNUC7421 zone)

EMBL: CP000462.PE154

CP000462.PE154       Location/Qualifiers
FT   CDS             185610..186653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0167"
FT                   /product="heptosyltransferase"
FT                   /note="identified by match to protein family HMM PF01075"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39719"
FT                   /db_xref="GOA:A0KEN5"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN5"
FT                   /protein_id="ABK39719.1"
FT                   /translation="MKRILVVRNDKIGDFMLAWPSFAMLKRSMECHVTALVPAYTAPLA
FT                   RLCPWIDEIILDPGSRADKEQQRALQARIKAAAFDASICLFSNSRNAMLVWKAHIPYRL
FT                   APATKLAQVLYNQRLIQRRSRSQKPEYEYNLDLVRRFLADQQVSAVEPQGPYLSFDAKS
FT                   LQQVREQVAARLRLDAGRPWLMVHAGSGGSANNLSIEQYARLIIKLNQACPELQCILTA
FT                   GPGEERIAEQLAAELLAHGGNGWIYRSDEGLPKFCQVMANAALFVAGSTGPLHIAAALD
FT                   VPTIGFFPAHRSATPLRWRPLNSEGRHLAFSPPEDSDHPEDMSQLDPKTMAAAIARWAP
FT                   PFWRTEH"
     MKRILVVRND KIGDFMLAWP SFAMLKRSME CHVTALVPAY TAPLARLCPW IDEIILDPGS        60
     RADKEQQRAL QARIKAAAFD ASICLFSNSR NAMLVWKAHI PYRLAPATKL AQVLYNQRLI       120
     QRRSRSQKPE YEYNLDLVRR FLADQQVSAV EPQGPYLSFD AKSLQQVREQ VAARLRLDAG       180
     RPWLMVHAGS GGSANNLSIE QYARLIIKLN QACPELQCIL TAGPGEERIA EQLAAELLAH       240
     GGNGWIYRSD EGLPKFCQVM ANAALFVAGS TGPLHIAAAL DVPTIGFFPA HRSATPLRWR       300
     PLNSEGRHLA FSPPEDSDHP EDMSQLDPKT MAAAIARWAP PFWRTEH                     347
//

If you have problems or comments...

PBIL Back to PBIL home page