(data stored in ACNUC7421 zone)

EMBL: CP000462.PE155

CP000462.PE155       Location/Qualifiers
FT   CDS             complement(186723..187511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0168"
FT                   /product="glycosyl transferase, group 2 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35829"
FT                   /db_xref="GOA:A0KEN6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEN6"
FT                   /protein_id="ABK35829.1"
FT                   /translation="MNKPTLAAVLIVKNEAENLRPCLASLDGLVDEIVIMDSGSQDETP
FT                   TIAAEFGARFFVNPVWPGFGRQRRLAQSHVQSDWVLWLDADERLTPELKAAIAAVMANP
FT                   ASDTIYSIPRLSWVFGRFIRHSGWYPDRVLRLYPKALTSYNEVLVHEKVEVRANMKIVN
FT                   LHGDLLHFTYRDLEHYLVKSAGYARAWADQRTARGKKGSLSQGLVHALGCFLKMYLLKA
FT                   GFLDGKQGLLLAILSAHSTFVKYADLWIRQQPQAPDQADK"
     MNKPTLAAVL IVKNEAENLR PCLASLDGLV DEIVIMDSGS QDETPTIAAE FGARFFVNPV        60
     WPGFGRQRRL AQSHVQSDWV LWLDADERLT PELKAAIAAV MANPASDTIY SIPRLSWVFG       120
     RFIRHSGWYP DRVLRLYPKA LTSYNEVLVH EKVEVRANMK IVNLHGDLLH FTYRDLEHYL       180
     VKSAGYARAW ADQRTARGKK GSLSQGLVHA LGCFLKMYLL KAGFLDGKQG LLLAILSAHS       240
     TFVKYADLWI RQQPQAPDQA DK                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page