(data stored in ACNUC7421 zone)

EMBL: CP000462.PE159

CP000462.PE159       Location/Qualifiers
FT   CDS             complement(191523..191846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0172"
FT                   /product="PTS sysytem, mannitol-specific enzyme II, B
FT                   component"
FT                   /note="identified by match to protein family HMM PF02302"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36374"
FT                   /db_xref="GOA:A0KEP0"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP0"
FT                   /protein_id="ABK36374.1"
FT                   /translation="MSGALRPTEEEHMKILVVCGHGLGTSLMMEMSIKSILKELAVTAE
FT                   VDHRDLASAGSERAEIFVATRDIAEQLVSMGVDGRLVSLDNMVDKAAMKEKLAIALREL
FT                   GAL"
     MSGALRPTEE EHMKILVVCG HGLGTSLMME MSIKSILKEL AVTAEVDHRD LASAGSERAE        60
     IFVATRDIAE QLVSMGVDGR LVSLDNMVDK AAMKEKLAIA LRELGAL                     107
//

If you have problems or comments...

PBIL Back to PBIL home page