(data stored in ACNUC7421 zone)

EMBL: CP000462.PE160

CP000462.PE160       Location/Qualifiers
FT   CDS             complement(191843..192286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0173"
FT                   /product="ascorbate-specific phosphotransferase enzyme IIA
FT                   component"
FT                   /EC_number="2.7.1.-"
FT                   /note="identified by match to protein family HMM PF00359"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39332"
FT                   /db_xref="GOA:A0KEP1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP1"
FT                   /protein_id="ABK39332.1"
FT                   /translation="MLTQLLTEEVISIEAGARDWRHAIELATAPLLANGTIEPSYVAAL
FT                   YRSHEELGPYYVLGPGLAMPHARPEDGVNRLGLALTVLKEGVNFGSEGNDPVRLLVTLA
FT                   ASDSNSHVETIAQLAELFMNEEDVAAIMAATSKDDILRILARY"
     MLTQLLTEEV ISIEAGARDW RHAIELATAP LLANGTIEPS YVAALYRSHE ELGPYYVLGP        60
     GLAMPHARPE DGVNRLGLAL TVLKEGVNFG SEGNDPVRLL VTLAASDSNS HVETIAQLAE       120
     LFMNEEDVAA IMAATSKDDI LRILARY                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page