(data stored in ACNUC7421 zone)

EMBL: CP000462.PE161

CP000462.PE161       Location/Qualifiers
FT   CDS             192539..193561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0174"
FT                   /product="HTH-type transcriptional regulator GntR"
FT                   /note="identified by match to protein family HMM PF00356;
FT                   match to protein family HMM PF00532"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37589"
FT                   /db_xref="GOA:A0KEP2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP2"
FT                   /protein_id="ABK37589.1"
FT                   /translation="MSEAKKRRSTGRVTLNDVAQLAGVGAMTVSRALRTPELVSDKMRE
FT                   RIEAAVDELGYIPNRAAGALASATSQTIVVIVPSLTECGCGEVIAGLQQTLRGEGYQIM
FT                   LGDAQHLKQQEESLLTSFLQHNPAAVVLFGSDPGETIRQRLQAARLPVVEVGAMARSPI
FT                   DMNVGVSNFDAGYQLTRHLIERGYRNIGFLCARQEQWMLQQRMQGWQKALLDNYLSPDA
FT                   IINTSERPSFSTGAAMLGEFLLRWPELDALVCVNDELAAGVLFECQRRHLNVPGKLAIA
FT                   GFDDLDVARACYPALTSVRIPYQRMGEEAADLILRQLVGEPVMGSALTLDFQLQKRQSS
FT                   "
     MSEAKKRRST GRVTLNDVAQ LAGVGAMTVS RALRTPELVS DKMRERIEAA VDELGYIPNR        60
     AAGALASATS QTIVVIVPSL TECGCGEVIA GLQQTLRGEG YQIMLGDAQH LKQQEESLLT       120
     SFLQHNPAAV VLFGSDPGET IRQRLQAARL PVVEVGAMAR SPIDMNVGVS NFDAGYQLTR       180
     HLIERGYRNI GFLCARQEQW MLQQRMQGWQ KALLDNYLSP DAIINTSERP SFSTGAAMLG       240
     EFLLRWPELD ALVCVNDELA AGVLFECQRR HLNVPGKLAI AGFDDLDVAR ACYPALTSVR       300
     IPYQRMGEEA ADLILRQLVG EPVMGSALTL DFQLQKRQSS                             340
//

If you have problems or comments...

PBIL Back to PBIL home page