(data stored in ACNUC7421 zone)

EMBL: CP000462.PE162

CP000462.PE162       Location/Qualifiers
FT   CDS             193591..194571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0175"
FT                   /product="putative quinone oxidoreductase, YhdH/YhfP
FT                   family"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02823"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38056"
FT                   /db_xref="GOA:A0KEP3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP3"
FT                   /protein_id="ABK38056.1"
FT                   /translation="MFKALLLENQDGKTVPTLTRLDESQLPAGEVRVAVSYSSLNYKDG
FT                   LAITGKGKIVRQWPLVPGIDFAGTVLESADDRYQPGDKVVLTGWGVGEGHWGGMAEQAR
FT                   VKADWLVPLPAGLDERQAMCIGTAGLTAMLCVLALEEAGVTPQSGEILVTGAAGGVGST
FT                   AVALLAALGYQVAALTGRPEAQGELLTALGASRIVPRSELLEPAKPLEKQLWAGAVDTV
FT                   GSQVLAKLLAQMNYGGAVAACGLAGGFDLPTSVMPFILRNVRLQGVDSVMCPLARRQLA
FT                   WQRLARDLPASFFAQAVTEIGLEQVAEAAEAITQGQIAGRTLVKL"
     MFKALLLENQ DGKTVPTLTR LDESQLPAGE VRVAVSYSSL NYKDGLAITG KGKIVRQWPL        60
     VPGIDFAGTV LESADDRYQP GDKVVLTGWG VGEGHWGGMA EQARVKADWL VPLPAGLDER       120
     QAMCIGTAGL TAMLCVLALE EAGVTPQSGE ILVTGAAGGV GSTAVALLAA LGYQVAALTG       180
     RPEAQGELLT ALGASRIVPR SELLEPAKPL EKQLWAGAVD TVGSQVLAKL LAQMNYGGAV       240
     AACGLAGGFD LPTSVMPFIL RNVRLQGVDS VMCPLARRQL AWQRLARDLP ASFFAQAVTE       300
     IGLEQVAEAA EAITQGQIAG RTLVKL                                            326
//

If you have problems or comments...

PBIL Back to PBIL home page