(data stored in ACNUC7421 zone)

EMBL: CP000462.PE164

CP000462.PE164       Location/Qualifiers
FT   CDS             194898..195239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36971"
FT                   /db_xref="InterPro:IPR021242"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP5"
FT                   /protein_id="ABK36971.1"
FT                   /translation="MIMRLSVIVFAVLLGGCASHSDDPCEKVWSEVGEADGKLGFTAER
FT                   VEFHQAQCGEKVDAELWKQGHQKGLAWYCRPEHLYLAGRSGGEYRGVCPNDVQARRLFE
FT                   QGRQGWTDQ"
     MIMRLSVIVF AVLLGGCASH SDDPCEKVWS EVGEADGKLG FTAERVEFHQ AQCGEKVDAE        60
     LWKQGHQKGL AWYCRPEHLY LAGRSGGEYR GVCPNDVQAR RLFEQGRQGW TDQ              113
//

If you have problems or comments...

PBIL Back to PBIL home page