(data stored in ACNUC7421 zone)

EMBL: CP000462.PE165

CP000462.PE165       Location/Qualifiers
FT   CDS             complement(195253..195471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0178"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39016"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEP6"
FT                   /protein_id="ABK39016.1"
FT                   /translation="MKIDYTRAHRVVEVVEMGNKTLCEWRRSEIPADLKTLRKIVRKPK
FT                   FVCGKCARSANDKSYLCQPLRLKEKEV"
     MKIDYTRAHR VVEVVEMGNK TLCEWRRSEI PADLKTLRKI VRKPKFVCGK CARSANDKSY        60
     LCQPLRLKEK EV                                                            72
//

If you have problems or comments...

PBIL Back to PBIL home page