(data stored in ACNUC7421 zone)

EMBL: CP000462.PE167

CP000462.PE167       Location/Qualifiers
FT   CDS             196109..196645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0180"
FT                   /product="chorismate--pyruvate lyase"
FT                   /EC_number="4.-.-.-"
FT                   /note="identified by match to protein family HMM PF04345"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37637"
FT                   /db_xref="GOA:A0KEP8"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEP8"
FT                   /protein_id="ABK37637.1"
FT                   /translation="MKSELTVPLARLVPWQTPAQCEPPEALLPWLLEADSMTRRLRRHN
FT                   RHFSVQLFGNRSVALDADEQQLVVAEQPMGLCREVILHGDHGPAVLGWTLFAEAALQES
FT                   GLRELGEQPLGERIFGDEPARRDHLQLACFEIASNPWCPAGTVWGRRSRLFLGQWPLLV
FT                   HELFLPSLSCNKELE"
     MKSELTVPLA RLVPWQTPAQ CEPPEALLPW LLEADSMTRR LRRHNRHFSV QLFGNRSVAL        60
     DADEQQLVVA EQPMGLCREV ILHGDHGPAV LGWTLFAEAA LQESGLRELG EQPLGERIFG       120
     DEPARRDHLQ LACFEIASNP WCPAGTVWGR RSRLFLGQWP LLVHELFLPS LSCNKELE         178
//

If you have problems or comments...

PBIL Back to PBIL home page