(data stored in ACNUC7421 zone)

EMBL: CP000462.PE171

CP000462.PE171       Location/Qualifiers
FT   CDS             201261..201548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0184"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39905"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ2"
FT                   /protein_id="ABK39905.1"
FT                   /translation="MASSSPWDPGLASPVSSITRFIKGNRMTRFYALWVHHKGACWTIW
FT                   LGCPKDKIVRLVRLFHSHHDGGLADAPWTAPVIPLRAQSRRPHERRRQQP"
     MASSSPWDPG LASPVSSITR FIKGNRMTRF YALWVHHKGA CWTIWLGCPK DKIVRLVRLF        60
     HSHHDGGLAD APWTAPVIPL RAQSRRPHER RRQQP                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page