(data stored in ACNUC7421 zone)

EMBL: CP000462.PE173

CP000462.PE173       Location/Qualifiers
FT   CDS             201710..202396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0186"
FT                   /product="SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38466"
FT                   /db_xref="GOA:A0KEQ4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ4"
FT                   /protein_id="ABK38466.1"
FT                   /translation="MALPFGPGWRVCRSERVCSLMVKPRYPLLFLLLVGGMMAGFYWNQ
FT                   PSLPEHADYYPAGRDINPFAFTDQDGQPFVPASLTGHWTFLFVGYTFCPDICPTTLADL
FT                   RSVYPELKKIAPNSQVVFISADPQRDDVARLKTYTAFFNPEFKAATGPHDKLFPFVRNL
FT                   GLIYSIADQGEKDYLIDHSASIVLINPAGKLEAVFRPRLSEGSVPRVVMASMVSDFAKI
FT                   VRLDDA"
     MALPFGPGWR VCRSERVCSL MVKPRYPLLF LLLVGGMMAG FYWNQPSLPE HADYYPAGRD        60
     INPFAFTDQD GQPFVPASLT GHWTFLFVGY TFCPDICPTT LADLRSVYPE LKKIAPNSQV       120
     VFISADPQRD DVARLKTYTA FFNPEFKAAT GPHDKLFPFV RNLGLIYSIA DQGEKDYLID       180
     HSASIVLINP AGKLEAVFRP RLSEGSVPRV VMASMVSDFA KIVRLDDA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page