(data stored in ACNUC7421 zone)

EMBL: CP000462.PE174

CP000462.PE174       Location/Qualifiers
FT   CDS             202386..203804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0187"
FT                   /product="DNA-damage-inducible protein F"
FT                   /note="identified by match to protein family HMM PF01554;
FT                   match to protein family HMM TIGR00797"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37282"
FT                   /db_xref="GOA:A0KEQ5"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEQ5"
FT                   /protein_id="ABK37282.1"
FT                   /translation="MTHDEQRTPSDMLTPVWWRDGRRHRAVFALALPMVFSNVTTPLLG
FT                   LVDTWVIGHLGQAWFLGGVSVGATLINLLFWLLGFLRMSTTGLTAQAHGASSPAGQLDT
FT                   LARALGLAVGLGVTLLLLLLPLIPTLIALSGGSAEVQHYAAEYVSVRVWSAPAALCNLV
FT                   IMGWLLGMQDARSPMLLLIFTNLVNMGLDAWFVLGLGWQVKGVAAASLLADYSALGLGL
FT                   WLVSRHLRRLAASAWQGAWQRWRQWPALLRLLALNRDIFIRSLCLQLCFAFMTLQGARL
FT                   GDVAVAANAVLLNFLMLISYGLDGFAYAVEAMVGRAIGRRDRQGLREAIVLNLGWALLI
FT                   ALTFSLLFAVGGSRLIAHITDLPAVIAAANAQLPWLIAMPLLAVWCFLLDGVFIGATRA
FT                   REMRNSMLVAALCGFFPVWWLCQGWGVAALWAAMAALMAGRGLTLGWLCWQLERDGRLL
FT                   HSAHGVGEAQQASS"
     MTHDEQRTPS DMLTPVWWRD GRRHRAVFAL ALPMVFSNVT TPLLGLVDTW VIGHLGQAWF        60
     LGGVSVGATL INLLFWLLGF LRMSTTGLTA QAHGASSPAG QLDTLARALG LAVGLGVTLL       120
     LLLLPLIPTL IALSGGSAEV QHYAAEYVSV RVWSAPAALC NLVIMGWLLG MQDARSPMLL       180
     LIFTNLVNMG LDAWFVLGLG WQVKGVAAAS LLADYSALGL GLWLVSRHLR RLAASAWQGA       240
     WQRWRQWPAL LRLLALNRDI FIRSLCLQLC FAFMTLQGAR LGDVAVAANA VLLNFLMLIS       300
     YGLDGFAYAV EAMVGRAIGR RDRQGLREAI VLNLGWALLI ALTFSLLFAV GGSRLIAHIT       360
     DLPAVIAAAN AQLPWLIAMP LLAVWCFLLD GVFIGATRAR EMRNSMLVAA LCGFFPVWWL       420
     CQGWGVAALW AAMAALMAGR GLTLGWLCWQ LERDGRLLHS AHGVGEAQQA SS               472
//

If you have problems or comments...

PBIL Back to PBIL home page