(data stored in ACNUC7421 zone)

EMBL: CP000462.PE175

CP000462.PE175       Location/Qualifiers
FT   CDS             complement(203833..204339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0188"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="identified by match to protein family HMM PF00588;
FT                   match to protein family HMM TIGR00185"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36903"
FT                   /db_xref="GOA:A0KEQ6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEQ6"
FT                   /protein_id="ABK36903.1"
FT                   /translation="MLAPFSPHQDAVMLDIVLYQPEIPPNTGNIIRLCANTGYRLHLIE
FT                   PLGFEWDDKRVKRAGLDYHEFAEVKRWPNFEAFLEAVAPTRVFACTTKGRTAHSAVQFA
FT                   AGDALLFGPESRGLPIEIIESLPFEQRLRIPMLPQSRSMNLANAVAVFVYESWRQLGYA
FT                   GSLQE"
     MLAPFSPHQD AVMLDIVLYQ PEIPPNTGNI IRLCANTGYR LHLIEPLGFE WDDKRVKRAG        60
     LDYHEFAEVK RWPNFEAFLE AVAPTRVFAC TTKGRTAHSA VQFAAGDALL FGPESRGLPI       120
     EIIESLPFEQ RLRIPMLPQS RSMNLANAVA VFVYESWRQL GYAGSLQE                    168
//

If you have problems or comments...

PBIL Back to PBIL home page