(data stored in ACNUC7421 zone)

EMBL: CP000462.PE184

CP000462.PE184       Location/Qualifiers
FT   CDS             complement(213909..214448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0197"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36216"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER5"
FT                   /protein_id="ABK36216.1"
FT                   /translation="MDLRLRPYKGKRPQLGKRVYVDPCATLVGDIQLGDDASIWPMVAA
FT                   RGDVNHICIGARSNIQDGTVLHLTRKSASNPGGYPLLIGEDVTVGHKAMLHGCTIGNRV
FT                   LVGMGAILLDGVIVEDDVMIGAGSLVPPGKRLEAGFLYMGNPVQQARTLKPAEIAFLKT
FT                   SADNYVLLKDEYLQEA"
     MDLRLRPYKG KRPQLGKRVY VDPCATLVGD IQLGDDASIW PMVAARGDVN HICIGARSNI        60
     QDGTVLHLTR KSASNPGGYP LLIGEDVTVG HKAMLHGCTI GNRVLVGMGA ILLDGVIVED       120
     DVMIGAGSLV PPGKRLEAGF LYMGNPVQQA RTLKPAEIAF LKTSADNYVL LKDEYLQEA        179
//

If you have problems or comments...

PBIL Back to PBIL home page