(data stored in ACNUC7421 zone)

EMBL: CP000462.PE186

CP000462.PE186       Location/Qualifiers
FT   CDS             221807..224881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0205"
FT                   /product="evolved beta-galactosidase alpha-subunit"
FT                   /EC_number="3.2.1.23"
FT                   /note="identified by match to protein family HMM PF00703;
FT                   match to protein family HMM PF02836; match to protein
FT                   family HMM PF02837; match to protein family HMM PF02929"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37231"
FT                   /db_xref="GOA:A0KER7"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER7"
FT                   /protein_id="ABK37231.1"
FT                   /translation="MNNWENVQFVGENRLAPRAYFFSYADHALAATMQRELSRRFLSLS
FT                   GQWQFHYFDHPLQVPEAFYHSPMSEWDQITVPNMWQMEGHGQLQYTDEGFPFPIDVPFV
FT                   PTNNPTGAYQRSFTLSQAWDGEQVIIKFDGVETYFEVYVNGHYIGFSKGSRLTAEFDIS
FT                   AYAKVGENLLSVRVMQWADSTYIEDQDMWWMAGIFRDVYLVGKPAAHVQDFFIRTALAD
FT                   DNQSATLSCDIQLENLGAAARDHRLVWSLLDQGSEIASGSLDHLAIDGKCDCRFTLDLA
FT                   NPHLWSAEDPYLYQLQLSLYNGQGELLEVIPQRVGVREIKVKDGLFYVNGHYLKLHGVN
FT                   RHDNDHLKSRAVGMDRVERDIVLMKQHNLNSVRTAHYPNDPRFYELCDQYGLFVMAETD
FT                   VETHGFANVGDLSRITDDPFWEPVFVDRIERHVHAQKNHPSIIIWSLGNESGYGCNIRA
FT                   MYRRCKQMDPTRLVHYEEDRDAEVVDLVSTMYSRVSQMNCFGEFPMPKPRILCEYAHAM
FT                   GNGPGGLSEYQQVFDRHPHIQGHYIWEWCDHGILDQDEQGRPVYKYGGDYGDYPNNYNF
FT                   CMDGLIYPDQTPGPGLREYKQVICPVKVRALDLASGKLEVENRYWFSNLDDIRLLVEVK
FT                   AEGELLASQQIRLEGVAPGATTELQLELPSLDGRETFVQLRVIKATATRYSAAEHELGQ
FT                   YQFQLKESTRQLQPFANPNATALQIADERLALTLSGSGFALRFSRLDGKLVSWQQDGNE
FT                   LIERAPRLTFFKPMIDNHKQEYESLWHPNHLQIMQEHFRTLSWRQLGEVVEVTVESLIA
FT                   PPVFDFGMRCRYVYTLSPNGQLHVALSGQPYGGYDDIIPKIGFELGIRQDLDRVHYYGM
FT                   GPGENYQDSRQSNWIDSFQSTVGEMWEHYPFPQDNGNRQQVRWATLTNRHGAGLYVRPD
FT                   APINLSVWPYSWEHIHAAQHINELEPSGYLTLNLDHKVLGLGSNSWGSEVLDSWRVRFE
FT                   PFSFGLTLLPIARGNLNPAALAGLDLTINGGRNLA"
     MNNWENVQFV GENRLAPRAY FFSYADHALA ATMQRELSRR FLSLSGQWQF HYFDHPLQVP        60
     EAFYHSPMSE WDQITVPNMW QMEGHGQLQY TDEGFPFPID VPFVPTNNPT GAYQRSFTLS       120
     QAWDGEQVII KFDGVETYFE VYVNGHYIGF SKGSRLTAEF DISAYAKVGE NLLSVRVMQW       180
     ADSTYIEDQD MWWMAGIFRD VYLVGKPAAH VQDFFIRTAL ADDNQSATLS CDIQLENLGA       240
     AARDHRLVWS LLDQGSEIAS GSLDHLAIDG KCDCRFTLDL ANPHLWSAED PYLYQLQLSL       300
     YNGQGELLEV IPQRVGVREI KVKDGLFYVN GHYLKLHGVN RHDNDHLKSR AVGMDRVERD       360
     IVLMKQHNLN SVRTAHYPND PRFYELCDQY GLFVMAETDV ETHGFANVGD LSRITDDPFW       420
     EPVFVDRIER HVHAQKNHPS IIIWSLGNES GYGCNIRAMY RRCKQMDPTR LVHYEEDRDA       480
     EVVDLVSTMY SRVSQMNCFG EFPMPKPRIL CEYAHAMGNG PGGLSEYQQV FDRHPHIQGH       540
     YIWEWCDHGI LDQDEQGRPV YKYGGDYGDY PNNYNFCMDG LIYPDQTPGP GLREYKQVIC       600
     PVKVRALDLA SGKLEVENRY WFSNLDDIRL LVEVKAEGEL LASQQIRLEG VAPGATTELQ       660
     LELPSLDGRE TFVQLRVIKA TATRYSAAEH ELGQYQFQLK ESTRQLQPFA NPNATALQIA       720
     DERLALTLSG SGFALRFSRL DGKLVSWQQD GNELIERAPR LTFFKPMIDN HKQEYESLWH       780
     PNHLQIMQEH FRTLSWRQLG EVVEVTVESL IAPPVFDFGM RCRYVYTLSP NGQLHVALSG       840
     QPYGGYDDII PKIGFELGIR QDLDRVHYYG MGPGENYQDS RQSNWIDSFQ STVGEMWEHY       900
     PFPQDNGNRQ QVRWATLTNR HGAGLYVRPD APINLSVWPY SWEHIHAAQH INELEPSGYL       960
     TLNLDHKVLG LGSNSWGSEV LDSWRVRFEP FSFGLTLLPI ARGNLNPAAL AGLDLTINGG      1020
     RNLA                                                                   1024
//

If you have problems or comments...

PBIL Back to PBIL home page