(data stored in ACNUC7421 zone)

EMBL: CP000462.PE187

CP000462.PE187       Location/Qualifiers
FT   CDS             224494..225333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0206"
FT                   /product="evolved beta-D-galactosidase, beta subunit;
FT                   cryptic gene"
FT                   /note="identified by match to protein family HMM PF04074"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36897"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:A0KER8"
FT                   /protein_id="ABK36897.1"
FT                   /translation="MGALPLPAGQRQPPAGALGDPDQSPRRRSLRAARCPHQPERLALQ
FT                   LGAHPRGAAHQRAGAEWLSHPQSGSQGTGAGLQLLGFRGAGLLAGALRAVQLRPDPAAH
FT                   RPWQPQSGCAGRARSHHQRREEPRMITLDNLTLFKNIYREGKKWGRCVEAINNLANLKP
FT                   GICHSIGDSLTYRLQEGASPATSLFEGQRRYFDVHYYLEGEETVEWAAKSDLRVEQGYD
FT                   DTTDREWLVGEVRERQQVGNGQVVIFENDEAYRFVGDAPVRKLIIKVTVEGGYFKNK"
     MGALPLPAGQ RQPPAGALGD PDQSPRRRSL RAARCPHQPE RLALQLGAHP RGAAHQRAGA        60
     EWLSHPQSGS QGTGAGLQLL GFRGAGLLAG ALRAVQLRPD PAAHRPWQPQ SGCAGRARSH       120
     HQRREEPRMI TLDNLTLFKN IYREGKKWGR CVEAINNLAN LKPGICHSIG DSLTYRLQEG       180
     ASPATSLFEG QRRYFDVHYY LEGEETVEWA AKSDLRVEQG YDDTTDREWL VGEVRERQQV       240
     GNGQVVIFEN DEAYRFVGDA PVRKLIIKVT VEGGYFKNK                              279
//

If you have problems or comments...

PBIL Back to PBIL home page