(data stored in ACNUC7421 zone)

EMBL: CP000462.PE189

CP000462.PE189       Location/Qualifiers
FT   CDS             226910..227296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0208"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /note="identified by match to protein family HMM PF01588"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37873"
FT                   /db_xref="GOA:A0KES0"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES0"
FT                   /protein_id="ABK37873.1"
FT                   /translation="MVVGHPQTVEPEKEKSMSETIEFAEFKRVEMKVGKVLEVVRHPGA
FT                   DKLYIVQIDVGGEQPLQTVTSLVPYYSEEELMGSEVVVLTNLKPTRMRGERSECMLLCA
FT                   ETPDESQSVLLQPRVPMAPGTPIV"
     MVVGHPQTVE PEKEKSMSET IEFAEFKRVE MKVGKVLEVV RHPGADKLYI VQIDVGGEQP        60
     LQTVTSLVPY YSEEELMGSE VVVLTNLKPT RMRGERSECM LLCAETPDES QSVLLQPRVP       120
     MAPGTPIV                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page