(data stored in ACNUC7421 zone)

EMBL: CP000462.PE190

CP000462.PE190       Location/Qualifiers
FT   CDS             227463..228899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0209"
FT                   /product="amino acid permease"
FT                   /note="identified by match to protein family HMM PF00324"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39498"
FT                   /db_xref="GOA:A0KES1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES1"
FT                   /protein_id="ABK39498.1"
FT                   /translation="MSESVRGTIGKFALLSMTFAAVFNVRNIVNNNIELGLSSAPIFLL
FT                   ATLVYFIPFVFIIAEFVSANKNSESGMYDWLKKPLGTRMAYLGSFLYWFVNLFWFVSLL
FT                   PNVIAYASYAMLGYEYSFSPMVTSVISIVLFAAATHISTKGASWLGKIAEIVAYGVFAL
FT                   FAIYVLGALMALSGDHVPAQPITLEAMTPTVNWATLGIMCWIFQAAGGAETAAAYLNDV
FT                   KGGQKSFIKVIISAGIVIGAMYAVGSLLVNVFVPRESLTYAGGMVEIFTGMAQYFQLSE
FT                   ALVGRFVGVVLFIAMFGSMMMWTSAPVKIHFSEIPQGVYGEKTTQLNEHGVPVRAAWWQ
FT                   FAFVFVMLVVNGFGSESVQQMMNTAINLTAGTAMLPPIFIMVAYFVFRWKHDDTPREFR
FT                   MGSRTFGMGVVSVLIAIFVVSMSASAFPSGVDLVRAFFINVFMTAVFSALAYWWISRFE
FT                   KRQARKQATGTAGGKLAKQS"
     MSESVRGTIG KFALLSMTFA AVFNVRNIVN NNIELGLSSA PIFLLATLVY FIPFVFIIAE        60
     FVSANKNSES GMYDWLKKPL GTRMAYLGSF LYWFVNLFWF VSLLPNVIAY ASYAMLGYEY       120
     SFSPMVTSVI SIVLFAAATH ISTKGASWLG KIAEIVAYGV FALFAIYVLG ALMALSGDHV       180
     PAQPITLEAM TPTVNWATLG IMCWIFQAAG GAETAAAYLN DVKGGQKSFI KVIISAGIVI       240
     GAMYAVGSLL VNVFVPRESL TYAGGMVEIF TGMAQYFQLS EALVGRFVGV VLFIAMFGSM       300
     MMWTSAPVKI HFSEIPQGVY GEKTTQLNEH GVPVRAAWWQ FAFVFVMLVV NGFGSESVQQ       360
     MMNTAINLTA GTAMLPPIFI MVAYFVFRWK HDDTPREFRM GSRTFGMGVV SVLIAIFVVS       420
     MSASAFPSGV DLVRAFFINV FMTAVFSALA YWWISRFEKR QARKQATGTA GGKLAKQS         478
//

If you have problems or comments...

PBIL Back to PBIL home page