(data stored in ACNUC7421 zone)

EMBL: CP000462.PE195

CP000462.PE195       Location/Qualifiers
FT   CDS             complement(234317..235444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0214"
FT                   /product="alcohol dehydrogenase class III"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR02818"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39411"
FT                   /db_xref="GOA:A0KES6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES6"
FT                   /protein_id="ABK39411.1"
FT                   /translation="MAQVQSIKCKAAIAWGPGQPLSIEEVEVMPPQAGEVRVRIVATGV
FT                   CHTDAFTLSGEDPEGVFPCILGHEGGGIVESVGEGVTSVKVGDHVIPLYTPECGECKFC
FT                   KSGKTNLCQKIRATQGKGLMPDGTTRFSKDGQPIYHYMGTSTFSEYTVLPEISIAKVDP
FT                   AAPLEEVCLLGCGVTTGIGAVMNTAKVKEGESVAIFGLGGIGLSAVIGARLAKAGRIIA
FT                   IDINESKFELARKLGATDCINPNDYDKPIQEVIVELTDGGVDFSFECIGNVKVMRAALE
FT                   CCHKGWGESVIIGVAGAGQEISTRPFQLVTGRVWRGSAFGGVRGRSELPSYVQRYMQGE
FT                   FKLDDFITHTMGLEQINEAFDLMHEGKSIRSVIHY"
     MAQVQSIKCK AAIAWGPGQP LSIEEVEVMP PQAGEVRVRI VATGVCHTDA FTLSGEDPEG        60
     VFPCILGHEG GGIVESVGEG VTSVKVGDHV IPLYTPECGE CKFCKSGKTN LCQKIRATQG       120
     KGLMPDGTTR FSKDGQPIYH YMGTSTFSEY TVLPEISIAK VDPAAPLEEV CLLGCGVTTG       180
     IGAVMNTAKV KEGESVAIFG LGGIGLSAVI GARLAKAGRI IAIDINESKF ELARKLGATD       240
     CINPNDYDKP IQEVIVELTD GGVDFSFECI GNVKVMRAAL ECCHKGWGES VIIGVAGAGQ       300
     EISTRPFQLV TGRVWRGSAF GGVRGRSELP SYVQRYMQGE FKLDDFITHT MGLEQINEAF       360
     DLMHEGKSIR SVIHY                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page