(data stored in ACNUC7421 zone)

EMBL: CP000462.PE197

CP000462.PE197       Location/Qualifiers
FT   CDS             complement(236526..237491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0216"
FT                   /product="putative transport system permease abc
FT                   transporter protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38576"
FT                   /db_xref="GOA:A0KES8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES8"
FT                   /protein_id="ABK38576.1"
FT                   /translation="MFEILILMLDATIRTAPPLILAAMAGMFCERSGVVNIALEGKLLA
FT                   AAFASAAAAAVSGSAWIGLGAGVGVSILFALMHGFATITHRGDQVVSGMAINILAAGLT
FT                   VTLGRYWFDQGGQTPALSGAARFAPIDLPYAKELYDVPVISQLYSELLSGHSLLEYVAF
FT                   AAVPLAWWVLFRTRFGLRLRAVGEAPAAVDTAGISVVRMRYTALIIGGLLAGIGGTYLA
FT                   VAQTAQFIPNMSAGKGFMALAALVFGKWRPWNAMAACLLFGFLDAVAIRLQGVSIGGFP
FT                   IPVQAIEALPYILTVFLLAGFIGKAVAPKALGTPYVKERE"
     MFEILILMLD ATIRTAPPLI LAAMAGMFCE RSGVVNIALE GKLLAAAFAS AAAAAVSGSA        60
     WIGLGAGVGV SILFALMHGF ATITHRGDQV VSGMAINILA AGLTVTLGRY WFDQGGQTPA       120
     LSGAARFAPI DLPYAKELYD VPVISQLYSE LLSGHSLLEY VAFAAVPLAW WVLFRTRFGL       180
     RLRAVGEAPA AVDTAGISVV RMRYTALIIG GLLAGIGGTY LAVAQTAQFI PNMSAGKGFM       240
     ALAALVFGKW RPWNAMAACL LFGFLDAVAI RLQGVSIGGF PIPVQAIEAL PYILTVFLLA       300
     GFIGKAVAPK ALGTPYVKER E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page