(data stored in ACNUC7421 zone)

EMBL: CP000462.PE198

CP000462.PE198       Location/Qualifiers
FT   CDS             complement(237494..238609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0217"
FT                   /product="putative transport system permease abc
FT                   transporter protein"
FT                   /note="identified by match to protein family HMM PF02653"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37285"
FT                   /db_xref="GOA:A0KES9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:A0KES9"
FT                   /protein_id="ABK37285.1"
FT                   /translation="MSQARIPAWISVGVLPAVNILLAFLVSAILFYYLDINPVDAAEIM
FT                   WYGAFGTGEGVGFTLYYATGFIFTGLSVAVAFHAGLFNIGGEGQAYIGGLGVGLVCLLL
FT                   GDSLPFALLLPLAIIAGGLFGAAWAFIPAWLQAKRGSHIVITTIMFNFIAASLMAYLLV
FT                   EVFKPAGSMATESKVFAEASWLPKMSELAGAFGMEMSNSPLNISFFWALLCAALVWVFI
FT                   WHTRWGYEIRSVGASQSASAYAGISYPKVVILAMVISGMLSGFFALNVLQGELHQIKLN
FT                   FVEGFGFTGIAVALMGRNHPVGVIIASLLFGFLYQGGAELSFEFGVDRNIVVVLQGLVI
FT                   LFCGALEHMMRPRIEQLYLAFANRSAQVKGA"
     MSQARIPAWI SVGVLPAVNI LLAFLVSAIL FYYLDINPVD AAEIMWYGAF GTGEGVGFTL        60
     YYATGFIFTG LSVAVAFHAG LFNIGGEGQA YIGGLGVGLV CLLLGDSLPF ALLLPLAIIA       120
     GGLFGAAWAF IPAWLQAKRG SHIVITTIMF NFIAASLMAY LLVEVFKPAG SMATESKVFA       180
     EASWLPKMSE LAGAFGMEMS NSPLNISFFW ALLCAALVWV FIWHTRWGYE IRSVGASQSA       240
     SAYAGISYPK VVILAMVISG MLSGFFALNV LQGELHQIKL NFVEGFGFTG IAVALMGRNH       300
     PVGVIIASLL FGFLYQGGAE LSFEFGVDRN IVVVLQGLVI LFCGALEHMM RPRIEQLYLA       360
     FANRSAQVKG A                                                            371
//

If you have problems or comments...

PBIL Back to PBIL home page