(data stored in ACNUC7421 zone)

EMBL: CP000462.PE199

CP000462.PE199       Location/Qualifiers
FT   CDS             complement(238692..240272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0218"
FT                   /product="ABC transporter, nucleotide binding/ATPase
FT                   protein (sugar/ribonucleotide)"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37005"
FT                   /db_xref="GOA:A0KET0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET0"
FT                   /protein_id="ABK37005.1"
FT                   /translation="MDQTDRYAIELRGIDKRFGEVYANKQIDLKVRKGSIHGIVGENGA
FT                   GKSTLMSIIYGFYHADKGEMFIDGNPFKPHGSQDAIAAGVGMVHQHFMLVNNFTVLENV
FT                   ILGAENGWHLGKSLAAAEKLLGELARDYGLEVPLHEKVEDLPVGLQQRVEILKALYRGA
FT                   RILILDEPTGVLTPQEADHLFEVLKKLRDQGATIILITHKLREILAITDQVSIMRRGEM
FT                   VAHVATKDTDKEQLAELMVGRKVRLKVDKGPTQPGDAKLKVDGLSYVDDARVERVKSIS
FT                   FEVRAGEVVGIAGVSGNGQSELLSLLGGILKPSKGSFTITGGGQAHEVSVSHPADPERV
FT                   RNFGLGHVPEDRHKMGLINRFEAKEAFILGYHRRPQYNKGWLQNKEAILQDCQAKMDKW
FT                   DVRPPHPEHKTANFSGGNQQKLVIAREVEQDPDVLLIGQPTRGVDIGAIEYIHQQIIAM
FT                   RDKGKAVLLVSVELDEIMSLSDRILVIADGRIVGELDAAKADERTIGLMMANIVPDEVA
FT                   ASQSQGATS"
     MDQTDRYAIE LRGIDKRFGE VYANKQIDLK VRKGSIHGIV GENGAGKSTL MSIIYGFYHA        60
     DKGEMFIDGN PFKPHGSQDA IAAGVGMVHQ HFMLVNNFTV LENVILGAEN GWHLGKSLAA       120
     AEKLLGELAR DYGLEVPLHE KVEDLPVGLQ QRVEILKALY RGARILILDE PTGVLTPQEA       180
     DHLFEVLKKL RDQGATIILI THKLREILAI TDQVSIMRRG EMVAHVATKD TDKEQLAELM       240
     VGRKVRLKVD KGPTQPGDAK LKVDGLSYVD DARVERVKSI SFEVRAGEVV GIAGVSGNGQ       300
     SELLSLLGGI LKPSKGSFTI TGGGQAHEVS VSHPADPERV RNFGLGHVPE DRHKMGLINR       360
     FEAKEAFILG YHRRPQYNKG WLQNKEAILQ DCQAKMDKWD VRPPHPEHKT ANFSGGNQQK       420
     LVIAREVEQD PDVLLIGQPT RGVDIGAIEY IHQQIIAMRD KGKAVLLVSV ELDEIMSLSD       480
     RILVIADGRI VGELDAAKAD ERTIGLMMAN IVPDEVAASQ SQGATS                      526
//

If you have problems or comments...

PBIL Back to PBIL home page