(data stored in ACNUC7421 zone)

EMBL: CP000462.PE205

CP000462.PE205       Location/Qualifiers
FT   CDS             247422..247934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0224"
FT                   /product="hypothetical protein"
FT                   /note="identified by Glimmer2; putative"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36594"
FT                   /db_xref="GOA:A0KET6"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET6"
FT                   /protein_id="ABK36594.1"
FT                   /translation="MSKWMPTLHRLGWWLLRKATLALLTSLLFMISFTLFQYASWWPAM
FT                   AEDTSLEWSGFSQGWTFAELVPAMLEFSAVLACAFLPLFLLTPRPLLLPLFAGLWLWQT
FT                   YDIAFMTATASTWLPHEIIWTFILPHTHWLLLTLLAPLLLIRQLGRRLFVVAPATQPEM
FT                   SRLADKP"
     MSKWMPTLHR LGWWLLRKAT LALLTSLLFM ISFTLFQYAS WWPAMAEDTS LEWSGFSQGW        60
     TFAELVPAML EFSAVLACAF LPLFLLTPRP LLLPLFAGLW LWQTYDIAFM TATASTWLPH       120
     EIIWTFILPH THWLLLTLLA PLLLIRQLGR RLFVVAPATQ PEMSRLADKP                  170
//

If you have problems or comments...

PBIL Back to PBIL home page