(data stored in ACNUC7421 zone)

EMBL: CP000462.PE208

CP000462.PE208       Location/Qualifiers
FT   CDS             250157..250657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0227"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37372"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:A0KET9"
FT                   /protein_id="ABK37372.1"
FT                   /translation="MNRDIVAQFIKMLTNLDQCLAKAEAHAAAKKFNVENFFGDRLIVD
FT                   MLPFSKQVLICCDSARAVVATASLSEPPVLGDDPKTMADLRAHVAKTLTYLQSKLDADF
FT                   SQYASGHYYPYWAGGKGMDGHTCVHEYGIPNFYFHLTMTYALLRKAGVELGKGDYLGAI
FT                   NLQ"
     MNRDIVAQFI KMLTNLDQCL AKAEAHAAAK KFNVENFFGD RLIVDMLPFS KQVLICCDSA        60
     RAVVATASLS EPPVLGDDPK TMADLRAHVA KTLTYLQSKL DADFSQYASG HYYPYWAGGK       120
     GMDGHTCVHE YGIPNFYFHL TMTYALLRKA GVELGKGDYL GAINLQ                      166
//

If you have problems or comments...

PBIL Back to PBIL home page