(data stored in ACNUC7421 zone)

EMBL: CP000462.PE209

CP000462.PE209       Location/Qualifiers
FT   CDS             complement(250746..251195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0228"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38067"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU0"
FT                   /protein_id="ABK38067.1"
FT                   /translation="MRTGTVRLHRVLKAPPMRIYRAFIEADALAKWLPPYGFTCRVEQL
FT                   EAQVGGHFRMAFTHFGNGNSHAFGGEYLELEPGKRIRYTDRFDDPNLPGVMHVTVILTG
FT                   VVCGTELAIVQEGIPEVIPVEMCYLGWQESLAQLAALVEPEIPAQ"
     MRTGTVRLHR VLKAPPMRIY RAFIEADALA KWLPPYGFTC RVEQLEAQVG GHFRMAFTHF        60
     GNGNSHAFGG EYLELEPGKR IRYTDRFDDP NLPGVMHVTV ILTGVVCGTE LAIVQEGIPE       120
     VIPVEMCYLG WQESLAQLAA LVEPEIPAQ                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page