(data stored in ACNUC7421 zone)

EMBL: CP000462.PE21

CP000462.PE21        Location/Qualifiers
FT   CDS             complement(24187..27267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0021"
FT                   /product="acriflavin resistance plasma membrane protein"
FT                   /note="identified by match to protein family HMM PF00873"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38722"
FT                   /db_xref="GOA:A0KR19"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR19"
FT                   /protein_id="ABK38722.1"
FT                   /translation="MRFTDIFIKRPILAISISFLIALLGVQAVFKMQVREYPEMTNTVV
FT                   TVSTSYYGASADLIQGFITQPLEQAIAQADNIDFMTSSTQLGSSTITAYMKLNTNPNAA
FT                   LSDILAKVNSVRSQLPKESEDPSVTMSTGSTTAVLYIGFTSPELNASQITDYLERVIKP
FT                   QLFTVGGVSKVDMYGGTKYALRVWLDPAKMAAFNLTAADVMSVLNSNNYQSATGQATGY
FT                   FTLYNGNAETQVNTTEELERLVVATRDGKVIRLADIAKVSLEKSHDTYRATANGREAVV
FT                   LAINAAPTANPINIAHDVLEMLPSLKSNMPSTMEANVLYDSTVAINESISEVIKTIAEA
FT                   AAIVLVVITLFLGSFRAVIIPIITIPLSLIGVVMVMQMFGFSINLMTLLAMVLAIGLVV
FT                   DDAIVVLENVDRHVKEGEEPFRAAIIGTREIAVPVIAMTVTLAAVYAPIALMGGITGSL
FT                   FKEFALTLAGAVFVSGIIALTLSPMMCAKMLKANEEPGKFESKVHHLLDRMTVRYDAML
FT                   HAVMQKRIVVVLFAVIVFASLPMLFKFIPSELAPNEDKGVMAVLGTAPSNVNLDYIQGT
FT                   MEQVNKVLDEQPEVAFSQVFSGVFNANQAFGIASMVPWSQREASQKEVLERVGKLVENV
FT                   PGMSITTFQFPELPGASSGLPIQFVITTPNNFESLYQVASEILTAAQGSGRFVYSELDL
FT                   QYDSATMKIKIDKDKAGAYGITMQDIGITLGTMMSDGYVNRIDLDGRSYEVIPQVERKY
FT                   RLNPESIKGYYVRAADGQSIPLGSLISIEVVGEPRALPHFNQLNSATIGAVLMPGTTMG
FT                   NAIAWLDATASEKLPQGYRYDYMGEARQFVTEGSALYATFALALAIIFLVLAIQFESAR
FT                   DPLVIMVSVPLAISGALIALAWGAATMNIYSQVGLITLVGLITKHGILICEVAKEEQLL
FT                   HGRNRMEAVMAAAKVRLRPILMTTAAMIAGLIPLLYATGAGAAQRFSIGIVIVAGLAIG
FT                   TLFTLFVLPVIYTYLASEHKPLPVFDESIPPKAKGSH"
     MRFTDIFIKR PILAISISFL IALLGVQAVF KMQVREYPEM TNTVVTVSTS YYGASADLIQ        60
     GFITQPLEQA IAQADNIDFM TSSTQLGSST ITAYMKLNTN PNAALSDILA KVNSVRSQLP       120
     KESEDPSVTM STGSTTAVLY IGFTSPELNA SQITDYLERV IKPQLFTVGG VSKVDMYGGT       180
     KYALRVWLDP AKMAAFNLTA ADVMSVLNSN NYQSATGQAT GYFTLYNGNA ETQVNTTEEL       240
     ERLVVATRDG KVIRLADIAK VSLEKSHDTY RATANGREAV VLAINAAPTA NPINIAHDVL       300
     EMLPSLKSNM PSTMEANVLY DSTVAINESI SEVIKTIAEA AAIVLVVITL FLGSFRAVII       360
     PIITIPLSLI GVVMVMQMFG FSINLMTLLA MVLAIGLVVD DAIVVLENVD RHVKEGEEPF       420
     RAAIIGTREI AVPVIAMTVT LAAVYAPIAL MGGITGSLFK EFALTLAGAV FVSGIIALTL       480
     SPMMCAKMLK ANEEPGKFES KVHHLLDRMT VRYDAMLHAV MQKRIVVVLF AVIVFASLPM       540
     LFKFIPSELA PNEDKGVMAV LGTAPSNVNL DYIQGTMEQV NKVLDEQPEV AFSQVFSGVF       600
     NANQAFGIAS MVPWSQREAS QKEVLERVGK LVENVPGMSI TTFQFPELPG ASSGLPIQFV       660
     ITTPNNFESL YQVASEILTA AQGSGRFVYS ELDLQYDSAT MKIKIDKDKA GAYGITMQDI       720
     GITLGTMMSD GYVNRIDLDG RSYEVIPQVE RKYRLNPESI KGYYVRAADG QSIPLGSLIS       780
     IEVVGEPRAL PHFNQLNSAT IGAVLMPGTT MGNAIAWLDA TASEKLPQGY RYDYMGEARQ       840
     FVTEGSALYA TFALALAIIF LVLAIQFESA RDPLVIMVSV PLAISGALIA LAWGAATMNI       900
     YSQVGLITLV GLITKHGILI CEVAKEEQLL HGRNRMEAVM AAAKVRLRPI LMTTAAMIAG       960
     LIPLLYATGA GAAQRFSIGI VIVAGLAIGT LFTLFVLPVI YTYLASEHKP LPVFDESIPP      1020
     KAKGSH                                                                 1026
//

If you have problems or comments...

PBIL Back to PBIL home page