(data stored in ACNUC7421 zone)

EMBL: CP000462.PE215

CP000462.PE215       Location/Qualifiers
FT   CDS             254484..255104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0234"
FT                   /product="lysine exporter protein, putative"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38904"
FT                   /db_xref="GOA:A0KEU6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEU6"
FT                   /protein_id="ABK38904.1"
FT                   /translation="MTLDYYTLYLLLAIGTVLSPGPAVIYTIGNTLTRGTRHAIAGFCG
FT                   VAVGILLVASLASLAVLWFTRWLAAGQQILTLGGALYLLYLGLNSWRQRAVSPVPGAGP
FT                   DRDCRRSFIKGALISLLNPKAIIFFTSLFPQFIDFRHGALGQCMLLAVTFSAVVLVVHG
FT                   GYCLVFHWVGAQGYGERFARGINRLSAVMFTGFALLLLFKGLR"
     MTLDYYTLYL LLAIGTVLSP GPAVIYTIGN TLTRGTRHAI AGFCGVAVGI LLVASLASLA        60
     VLWFTRWLAA GQQILTLGGA LYLLYLGLNS WRQRAVSPVP GAGPDRDCRR SFIKGALISL       120
     LNPKAIIFFT SLFPQFIDFR HGALGQCMLL AVTFSAVVLV VHGGYCLVFH WVGAQGYGER       180
     FARGINRLSA VMFTGFALLL LFKGLR                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page