(data stored in ACNUC7421 zone)

EMBL: CP000462.PE220

CP000462.PE220       Location/Qualifiers
FT   CDS             complement(263467..264210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0239"
FT                   /product="transporter, LysE family"
FT                   /note="identified by match to protein family HMM PF01810"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36947"
FT                   /db_xref="GOA:A0KEV1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV1"
FT                   /protein_id="ABK36947.1"
FT                   /translation="MGTPTNSALQSFTIRRPRNPPCCELDTVPEVSMFTSLFLTIGLIH
FT                   LIALASPGPDFALILRTSLHRPTALGAALGIALAILVHATLSLTGISLLIAEHPWLFIT
FT                   VKVVGALYLGWLGWGALKAAWHSSAELALHAGGEAQGWRKGVQRGIATNLLNPKALLFF
FT                   MGLLAAMVTPQVDGLTRGLLVLELFLLSLIWFGVLAWSLSTVRAQRLLGRVQRPLNLVT
FT                   GLLFGAVSLSILTGMAGEAYALVLH"
     MGTPTNSALQ SFTIRRPRNP PCCELDTVPE VSMFTSLFLT IGLIHLIALA SPGPDFALIL        60
     RTSLHRPTAL GAALGIALAI LVHATLSLTG ISLLIAEHPW LFITVKVVGA LYLGWLGWGA       120
     LKAAWHSSAE LALHAGGEAQ GWRKGVQRGI ATNLLNPKAL LFFMGLLAAM VTPQVDGLTR       180
     GLLVLELFLL SLIWFGVLAW SLSTVRAQRL LGRVQRPLNL VTGLLFGAVS LSILTGMAGE       240
     AYALVLH                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page