(data stored in ACNUC7421 zone)

EMBL: CP000462.PE221

CP000462.PE221       Location/Qualifiers
FT   CDS             complement(264194..265012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0240"
FT                   /product="transcriptional regulator, AraC/XylS family"
FT                   /note="identified by match to protein family HMM PF00165;
FT                   match to protein family HMM PF02311"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38375"
FT                   /db_xref="GOA:A0KEV2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV2"
FT                   /protein_id="ABK38375.1"
FT                   /translation="MSAPQSRIHYWQSRLLPGVELSHSHHREFSYGRHVHLDYHIGLVQ
FT                   QGGQKFIHKGSSHHLVRGELSTVNPDEMHDGLSLLPEGYEVRVFAIAPEQLARWLPDSP
FT                   EPFFDQGLQRRPDLYQGFARLHMYLDNPSPDGLLAESELLALLGELLHLAPERHALADP
FT                   QLRYLRDHLLARLDERHSLEDLAALFGLDRFAFLRQFKKKTGMTPYAWLKRLRLEQSKR
FT                   LLGSGLPVSEVALAVGFFDQSHFHHGFRQAFGLTPADFRQQMLAASGHAD"
     MSAPQSRIHY WQSRLLPGVE LSHSHHREFS YGRHVHLDYH IGLVQQGGQK FIHKGSSHHL        60
     VRGELSTVNP DEMHDGLSLL PEGYEVRVFA IAPEQLARWL PDSPEPFFDQ GLQRRPDLYQ       120
     GFARLHMYLD NPSPDGLLAE SELLALLGEL LHLAPERHAL ADPQLRYLRD HLLARLDERH       180
     SLEDLAALFG LDRFAFLRQF KKKTGMTPYA WLKRLRLEQS KRLLGSGLPV SEVALAVGFF       240
     DQSHFHHGFR QAFGLTPADF RQQMLAASGH AD                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page