(data stored in ACNUC7421 zone)

EMBL: CP000462.PE224

CP000462.PE224       Location/Qualifiers
FT   CDS             complement(266407..267903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0243"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="identified by match to protein family HMM PF00171"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39725"
FT                   /db_xref="GOA:A0KEV5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEV5"
FT                   /protein_id="ABK39725.1"
FT                   /translation="MSDLTLAQWQHKASHLTLPSQAFIDGSYRDAINGATLDCINPANG
FT                   KLLTKVAACDAADAELAVQAARAAFDDKRWSGLPPKQRKQILQRFAELMRLNKVELALL
FT                   ESLDMGKPIGDAMGYDAPAAANCIAWNAEAIDKIYDQVAPVEESALALVTREPLGVVAA
FT                   IVPWNFPLVMACWKLGPALATGNSVILKPSEKSPLTALRIAGLAKEAGIPDGVFNVLPG
FT                   FGHTVGEALAMHMDVDCITFTGSTKIGKHLVQCSGKSNLKRAFMECGGKSPNIILADAP
FT                   DLDAAAKSAAGAIFYNQGEVCTAASRLLVQNSIKPQFMDRLLAHAREWISANPLDPATR
FT                   IGAMVDHIQMEQVLNYIAIGQQEGAKLLLGGKRTNTESGGFYIEPTIFDEVTPEMRIFR
FT                   EEIFGPVLAVTGFDTLEEAIALGNDTDYGLAAAIWTADLNKAVKGSRALRAGTVFVNNW
FT                   DGGDMTMPFGGFKQSGNGRDKSLHALEKYTELKSTWIQLE"
     MSDLTLAQWQ HKASHLTLPS QAFIDGSYRD AINGATLDCI NPANGKLLTK VAACDAADAE        60
     LAVQAARAAF DDKRWSGLPP KQRKQILQRF AELMRLNKVE LALLESLDMG KPIGDAMGYD       120
     APAAANCIAW NAEAIDKIYD QVAPVEESAL ALVTREPLGV VAAIVPWNFP LVMACWKLGP       180
     ALATGNSVIL KPSEKSPLTA LRIAGLAKEA GIPDGVFNVL PGFGHTVGEA LAMHMDVDCI       240
     TFTGSTKIGK HLVQCSGKSN LKRAFMECGG KSPNIILADA PDLDAAAKSA AGAIFYNQGE       300
     VCTAASRLLV QNSIKPQFMD RLLAHAREWI SANPLDPATR IGAMVDHIQM EQVLNYIAIG       360
     QQEGAKLLLG GKRTNTESGG FYIEPTIFDE VTPEMRIFRE EIFGPVLAVT GFDTLEEAIA       420
     LGNDTDYGLA AAIWTADLNK AVKGSRALRA GTVFVNNWDG GDMTMPFGGF KQSGNGRDKS       480
     LHALEKYTEL KSTWIQLE                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page