(data stored in ACNUC7421 zone)

EMBL: CP000462.PE23

CP000462.PE23        Location/Qualifiers
FT   CDS             complement(28422..29045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0023"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="identified by match to protein family HMM PF00440"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39904"
FT                   /db_xref="GOA:A0KR17"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR032551"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR17"
FT                   /protein_id="ABK39904.1"
FT                   /translation="MPQSPPRMNERSFSRCDHPVMNKKERIFDAAHEVLGEQGFHGLSI
FT                   AVVAKKARVAAGTIYRYFSDKDDLIRQLYRHTILQCHPLVMEGVQTEEVSFEQFRRLWL
FT                   NIHAIFVDEPNALKCKLQYETSPLGAELEQDPVIKAAWAPLDRFFERGLEQGLFIDLPV
FT                   RVLQVLSLDCVANMALQSQVHQFELTQDQLEAVIRACWRAILTP"
     MPQSPPRMNE RSFSRCDHPV MNKKERIFDA AHEVLGEQGF HGLSIAVVAK KARVAAGTIY        60
     RYFSDKDDLI RQLYRHTILQ CHPLVMEGVQ TEEVSFEQFR RLWLNIHAIF VDEPNALKCK       120
     LQYETSPLGA ELEQDPVIKA AWAPLDRFFE RGLEQGLFID LPVRVLQVLS LDCVANMALQ       180
     SQVHQFELTQ DQLEAVIRAC WRAILTP                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page