(data stored in ACNUC7421 zone)

EMBL: CP000462.PE234

CP000462.PE234       Location/Qualifiers
FT   CDS             276404..277744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0253"
FT                   /product="DNA recombination protein RmuC"
FT                   /note="identified by match to protein family HMM PF02646"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABK37955"
FT                   /db_xref="GOA:A0KEW5"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEW5"
FT                   /protein_id="ABK37955.1"
FT                   /translation="MIEPGLWSLLLAGAVLAVGLGWLVGRRGAAQLAQQVLLSEERQQA
FT                   LQDRCDELQDEKLQSQQKLEQQQTLLIKLTARLKDAEATLRSERLAAAEKLQLQQEAEQ
FT                   RLSQQFENLANRIFEQNSGNFRELNQNSLDLLLTPLKEQLEGFRRQVGETHAQETAQRH
FT                   SLKFELERLAELNARMTEEAAALTRALKGDSKQQGNWGEVVLARILSECGLREGHEYHT
FT                   QVNIEVDRGKRYQPDVIVHLPQDKDIIIDAKVSLTAYERWYNSDDELEKAVALKEHVAS
FT                   VRNHIRELGRKDYQQLPGVRTLDYVLMFVAVEPAFLTAVEADPSLVRFGLDNNILLVSP
FT                   TNLMVALRTIENLWRYERQNQNARQIAERAGRLYEKLRLFVEEMQQLGGSLHRAQESYD
FT                   KAMGRLVNGRGNLIAQVERFRELGVEVTKTLPEPLVNRALEREDPAE"
     MIEPGLWSLL LAGAVLAVGL GWLVGRRGAA QLAQQVLLSE ERQQALQDRC DELQDEKLQS        60
     QQKLEQQQTL LIKLTARLKD AEATLRSERL AAAEKLQLQQ EAEQRLSQQF ENLANRIFEQ       120
     NSGNFRELNQ NSLDLLLTPL KEQLEGFRRQ VGETHAQETA QRHSLKFELE RLAELNARMT       180
     EEAAALTRAL KGDSKQQGNW GEVVLARILS ECGLREGHEY HTQVNIEVDR GKRYQPDVIV       240
     HLPQDKDIII DAKVSLTAYE RWYNSDDELE KAVALKEHVA SVRNHIRELG RKDYQQLPGV       300
     RTLDYVLMFV AVEPAFLTAV EADPSLVRFG LDNNILLVSP TNLMVALRTI ENLWRYERQN       360
     QNARQIAERA GRLYEKLRLF VEEMQQLGGS LHRAQESYDK AMGRLVNGRG NLIAQVERFR       420
     ELGVEVTKTL PEPLVNRALE REDPAE                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page