(data stored in ACNUC7421 zone)

EMBL: CP000462.PE24

CP000462.PE24        Location/Qualifiers
FT   CDS             29998..30399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0028"
FT                   /product="ricin-type beta-trefoil lectin domain, putative"
FT                   /note="identified by match to protein family HMM PF00652"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35934"
FT                   /db_xref="GOA:A0KED0"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:A0KED0"
FT                   /protein_id="ABK35934.1"
FT                   /translation="MQSTATSALVTDAGFCVALNDHNQLITQPCDQTVRQQFSWDAGAL
FT                   QLDQRCLVAKGVSELTMAECQDESRQWQWQEDRLFNSKADRCLDVAGRRHKPGTPLRLA
FT                   DCFGGANQSFAWQNKSSMFDKLNLKSLIW"
     MQSTATSALV TDAGFCVALN DHNQLITQPC DQTVRQQFSW DAGALQLDQR CLVAKGVSEL        60
     TMAECQDESR QWQWQEDRLF NSKADRCLDV AGRRHKPGTP LRLADCFGGA NQSFAWQNKS       120
     SMFDKLNLKS LIW                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page