(data stored in ACNUC7421 zone)

EMBL: CP000462.PE242

CP000462.PE242       Location/Qualifiers
FT   CDS             286038..286511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF04361"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39398"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEX3"
FT                   /protein_id="ABK39398.1"
FT                   /translation="MFDVLMYLFETYIHSDADVMVEQNELTDELSRAGFDKDEIEKALN
FT                   WLERLANLHDSEREVYVAASAQGSMRIYAPQELARLSTECRGFLLFLEQAQVLNAETRE
FT                   ICIERLLELDKPDIELDDLKWVVMMVLFNVPGSENAYQQMEELVFDESDGVIH"
     MFDVLMYLFE TYIHSDADVM VEQNELTDEL SRAGFDKDEI EKALNWLERL ANLHDSEREV        60
     YVAASAQGSM RIYAPQELAR LSTECRGFLL FLEQAQVLNA ETREICIERL LELDKPDIEL       120
     DDLKWVVMMV LFNVPGSENA YQQMEELVFD ESDGVIH                                157
//

If you have problems or comments...

PBIL Back to PBIL home page