(data stored in ACNUC7421 zone)

EMBL: CP000462.PE243

CP000462.PE243       Location/Qualifiers
FT   CDS             286567..287124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0262"
FT                   /product="topoisomerase DNA-binding C4 zinc finger domain
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01396"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38729"
FT                   /db_xref="GOA:A0KEX4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX4"
FT                   /protein_id="ABK38729.1"
FT                   /translation="MSKIDHHLFSAHEHAFEREPCPQCGAELVIRQGKHGPFLGCSAYP
FT                   VCDYIRSLTPSGRDIEKVLEGSACPDCGQPLAIKKGRYGLFVGCTQYPACQHIESLQES
FT                   DDTQILCPECGKGHLISRTSRYGKQFYSCDGYPHCKYVVNDKPVPMPCPQCGWGIMVEK
FT                   KVRGALRWICPQKKCGHQSEQV"
     MSKIDHHLFS AHEHAFEREP CPQCGAELVI RQGKHGPFLG CSAYPVCDYI RSLTPSGRDI        60
     EKVLEGSACP DCGQPLAIKK GRYGLFVGCT QYPACQHIES LQESDDTQIL CPECGKGHLI       120
     SRTSRYGKQF YSCDGYPHCK YVVNDKPVPM PCPQCGWGIM VEKKVRGALR WICPQKKCGH       180
     QSEQV                                                                   185
//

If you have problems or comments...

PBIL Back to PBIL home page