(data stored in ACNUC7421 zone)

EMBL: CP000462.PE248

CP000462.PE248       Location/Qualifiers
FT   CDS             290322..290582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07369"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ABK35942"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEX9"
FT                   /protein_id="ABK35942.1"
FT                   /translation="MNQGILFPELADWQAHEQRIHFPAQQMGALVDCYISRRRLEKMTG
FT                   LSLAREEDILRAFESVRFDIEDIAEKLIEEQEFAEDGAIYL"
     MNQGILFPEL ADWQAHEQRI HFPAQQMGAL VDCYISRRRL EKMTGLSLAR EEDILRAFES        60
     VRFDIEDIAE KLIEEQEFAE DGAIYL                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page