(data stored in ACNUC7421 zone)

EMBL: CP000462.PE251

CP000462.PE251       Location/Qualifiers
FT   CDS             293413..294189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0270"
FT                   /product="protein of unknown function"
FT                   /note="identified by match to protein family HMM PF04220"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39574"
FT                   /db_xref="GOA:A0KEY2"
FT                   /db_xref="InterPro:IPR007336"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KEY2"
FT                   /protein_id="ABK39574.1"
FT                   /translation="MVILCQNTSNMPRGCRSCGIRRPFMAGLVRDPALFLIHRPPCQHP
FT                   LPDLFEPETGFNPVICRSHSFMSAKQPNRKPAGKRKESDASAQEGRERKRAAKRKGLKA
FT                   GSRQQVEQAGKKSGTKQAKDPRIGSRKPVALIVEEKSSKPVAPKQIKEKKLVMTPEQEL
FT                   ASIENDDRLNDLLDRLDAGETLEATEQAWVDQRVDRYQELMDELGIIDTDDDEDEADFD
FT                   EADFDEPGQPASEEELWDRFTQVDYQPEPKPEPKKK"
     MVILCQNTSN MPRGCRSCGI RRPFMAGLVR DPALFLIHRP PCQHPLPDLF EPETGFNPVI        60
     CRSHSFMSAK QPNRKPAGKR KESDASAQEG RERKRAAKRK GLKAGSRQQV EQAGKKSGTK       120
     QAKDPRIGSR KPVALIVEEK SSKPVAPKQI KEKKLVMTPE QELASIENDD RLNDLLDRLD       180
     AGETLEATEQ AWVDQRVDRY QELMDELGII DTDDDEDEAD FDEADFDEPG QPASEEELWD       240
     RFTQVDYQPE PKPEPKKK                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page