(data stored in ACNUC7421 zone)

EMBL: CP000462.PE252

CP000462.PE252       Location/Qualifiers
FT   CDS             294201..294641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38990"
FT                   /db_xref="InterPro:IPR019617"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY3"
FT                   /protein_id="ABK38990.1"
FT                   /translation="MLAALLGGLILLGLAWYAGTLLARLKRQHDSQQQAVAARNERILE
FT                   SVRVIAHAVRDGQCDYSEGAIRLTNLLDALQIKGGRAFAGEFPGLYGLYEKVKDMPTHE
FT                   VRRALKRNEVMKMDLERSGYEAELEAQILEDVARLKDFQLSR"
     MLAALLGGLI LLGLAWYAGT LLARLKRQHD SQQQAVAARN ERILESVRVI AHAVRDGQCD        60
     YSEGAIRLTN LLDALQIKGG RAFAGEFPGL YGLYEKVKDM PTHEVRRALK RNEVMKMDLE       120
     RSGYEAELEA QILEDVARLK DFQLSR                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page