(data stored in ACNUC7421 zone)

EMBL: CP000462.PE257

CP000462.PE257       Location/Qualifiers
FT   CDS             complement(299818..300399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by similarity to GB:AAN57435.1"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36184"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEY8"
FT                   /protein_id="ABK36184.1"
FT                   /translation="MKNANPVWMLSLLLLVATGAQAAKVYSWTDSQGVVHYTDAPPPGQ
FT                   KAKEVDLRVAPFIGSSPRSVQVDNFNSLTGVDAKKEKEAAKLVIELLSPEQGSTLRDNT
FT                   GNVVFQGQISPQPPTQYDVRLTLDGKAAPIVKNSLAIRVENLDRGAHEAQLELLAKDGT
FT                   ILAKSKPVTFYLHRASINPAPKVTPLNNKG"
     MKNANPVWML SLLLLVATGA QAAKVYSWTD SQGVVHYTDA PPPGQKAKEV DLRVAPFIGS        60
     SPRSVQVDNF NSLTGVDAKK EKEAAKLVIE LLSPEQGSTL RDNTGNVVFQ GQISPQPPTQ       120
     YDVRLTLDGK AAPIVKNSLA IRVENLDRGA HEAQLELLAK DGTILAKSKP VTFYLHRASI       180
     NPAPKVTPLN NKG                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page