(data stored in ACNUC7421 zone)

EMBL: CP000462.PE262

CP000462.PE262       Location/Qualifiers
FT   CDS             complement(305617..306393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39106"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ3"
FT                   /protein_id="ABK39106.1"
FT                   /translation="MGIRFGCRLGGDHPVHSSILELHWSKTILPCKFMDFNLQAYQADH
FT                   LLHLSAKPQRRLTVQENAHHRWLEIDGVVQSAMSLTEPATLCLPHQQVIACLLPEQAGS
FT                   ILELGLGGGDLTRHLHQRWPDARHECVDLDEEVITLYQLFFQPDQHPQRTPTLHQADAL
FT                   AFLEQSEAQYDLILLDLFSQDGNPPLLFQERIYQALAPRLNGELIINLLPRTRLELTRV
FT                   LMLLEQWVGPTTPYPVPGLRNVLLHTAPRYELASDL"
     MGIRFGCRLG GDHPVHSSIL ELHWSKTILP CKFMDFNLQA YQADHLLHLS AKPQRRLTVQ        60
     ENAHHRWLEI DGVVQSAMSL TEPATLCLPH QQVIACLLPE QAGSILELGL GGGDLTRHLH       120
     QRWPDARHEC VDLDEEVITL YQLFFQPDQH PQRTPTLHQA DALAFLEQSE AQYDLILLDL       180
     FSQDGNPPLL FQERIYQALA PRLNGELIIN LLPRTRLELT RVLMLLEQWV GPTTPYPVPG       240
     LRNVLLHTAP RYELASDL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page