(data stored in ACNUC7421 zone)

EMBL: CP000462.PE267

CP000462.PE267       Location/Qualifiers
FT   CDS             complement(313393..314733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0286"
FT                   /product="Low-affinity gluconate transporter"
FT                   /note="identified by match to protein family HMM PF02447;
FT                   match to protein family HMM PF03600; match to protein
FT                   family HMM TIGR00791"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ABK39685"
FT                   /db_xref="GOA:A0KEZ8"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:A0KEZ8"
FT                   /protein_id="ABK39685.1"
FT                   /translation="MSDLSLIMTAAGSIVLLLFLVMKARLHAVVSLILVSMVAGLAAGM
FT                   NPADIAATIQKGMGGTLGFVAVVVALGAMFGKVMEVTGALDRVAHTLLGTFGVKRANWA
FT                   MSLTGFICALPLFFDVAVVLLIGVAFAIVRRGGGSVVKIGIALLAGIATCQAFLIPAPG
FT                   PILVASQLGADFGYMILFGLIAAVPALILAGPLFGELISKVVDVPLPADAQSSAHDDGQ
FT                   NLPSFGLAMGLIGLPLLLIGLKTIVGRFVEAGTPLHGWLEFIGHPFTAIMVACLAAFYL
FT                   LGIRRGMSRDEVMNVCNSAIQPAGVIILVTGAGGVFKQILVDSGVGAALGNMLADSGLP
FT                   IVALAFILAAAVRVIQGSATVAMLTACGLVLPMLEPLGLNGAQLAAVTIAIGGGAIVLS
FT                   HVNDSGFWLANRYLGLTEKQTLQTWTVMETIIGTTGGVMAMIIYSFL"
     MSDLSLIMTA AGSIVLLLFL VMKARLHAVV SLILVSMVAG LAAGMNPADI AATIQKGMGG        60
     TLGFVAVVVA LGAMFGKVME VTGALDRVAH TLLGTFGVKR ANWAMSLTGF ICALPLFFDV       120
     AVVLLIGVAF AIVRRGGGSV VKIGIALLAG IATCQAFLIP APGPILVASQ LGADFGYMIL       180
     FGLIAAVPAL ILAGPLFGEL ISKVVDVPLP ADAQSSAHDD GQNLPSFGLA MGLIGLPLLL       240
     IGLKTIVGRF VEAGTPLHGW LEFIGHPFTA IMVACLAAFY LLGIRRGMSR DEVMNVCNSA       300
     IQPAGVIILV TGAGGVFKQI LVDSGVGAAL GNMLADSGLP IVALAFILAA AVRVIQGSAT       360
     VAMLTACGLV LPMLEPLGLN GAQLAAVTIA IGGGAIVLSH VNDSGFWLAN RYLGLTEKQT       420
     LQTWTVMETI IGTTGGVMAM IIYSFL                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page