(data stored in ACNUC7421 zone)

EMBL: CP000462.PE27

CP000462.PE27        Location/Qualifiers
FT   CDS             33247..34461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0031"
FT                   /product="ABC-type Fe3+ transport system, periplasmic
FT                   component"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38931"
FT                   /db_xref="UniProtKB/TrEMBL:A0KR12"
FT                   /protein_id="ABK38931.1"
FT                   /translation="MLPFSTLQAASLTVLTSFSEAPVKAVIEGFAEQYPGVRIEVIYRR
FT                   TIPSLRLLTEAGAPKVDIIMSSSPTFFNTLDKAGLLAALPNETMPPKWLTPHTLGLGNK
FT                   VAVVGYSSSGIMYNRHYLAKYQLPLPTTWQQLASPLFMGHVMMSSPSQSGTTHMMVESV
FT                   LQQYGWQQGWALLMRLGGNLSAITARSFGVSDGISRGLAGAGLVIDSYALNSQARFDHV
FT                   GFNIMPDSVILPTYLGVARHSTQPASAALFIQYLLSDSGQAIIATPGMAKATLSQPRLA
FT                   RQTRYVTDKALLYRRAGLLKALFEQTITQQRPRLKMTWQGINGLNTHGEPWRVALLEQA
FT                   VAKASTPPLSEQEAQDPALLALFDGLYDREQGNPQAERVMHQWRQATEARLHEAQRLVE
FT                   QAARP"
     MLPFSTLQAA SLTVLTSFSE APVKAVIEGF AEQYPGVRIE VIYRRTIPSL RLLTEAGAPK        60
     VDIIMSSSPT FFNTLDKAGL LAALPNETMP PKWLTPHTLG LGNKVAVVGY SSSGIMYNRH       120
     YLAKYQLPLP TTWQQLASPL FMGHVMMSSP SQSGTTHMMV ESVLQQYGWQ QGWALLMRLG       180
     GNLSAITARS FGVSDGISRG LAGAGLVIDS YALNSQARFD HVGFNIMPDS VILPTYLGVA       240
     RHSTQPASAA LFIQYLLSDS GQAIIATPGM AKATLSQPRL ARQTRYVTDK ALLYRRAGLL       300
     KALFEQTITQ QRPRLKMTWQ GINGLNTHGE PWRVALLEQA VAKASTPPLS EQEAQDPALL       360
     ALFDGLYDRE QGNPQAERVM HQWRQATEAR LHEAQRLVEQ AARP                        404
//

If you have problems or comments...

PBIL Back to PBIL home page