(data stored in ACNUC7421 zone)

EMBL: CP000462.PE272

CP000462.PE272       Location/Qualifiers
FT   CDS             319139..319789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0291"
FT                   /product="Qnr"
FT                   /note="identified by match to protein family HMM PF00805"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ABK38882"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="PDB:3PSS"
FT                   /db_xref="PDB:3PSZ"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF03"
FT                   /protein_id="ABK38882.1"
FT                   /translation="MIKDKCFEGVRFEQQDLEGEQFQGCRFIGCNFSWLDLAECRFVDC
FT                   SFYDRESEQSCLLQGCDLREASFLRCDLTMADCSRSQCLGLELRDCQALGINFSRASFA
FT                   NQITVKSYFCEAHLTGNNFSYANFEGCLLEQCELSGNRWQGANLFGASLAGSDLSGSEF
FT                   GQIDWASVNLQGCDLRQCDLPGLDLRRVNLDGVQINEDQQQALLEQIGLIVFP"
     MIKDKCFEGV RFEQQDLEGE QFQGCRFIGC NFSWLDLAEC RFVDCSFYDR ESEQSCLLQG        60
     CDLREASFLR CDLTMADCSR SQCLGLELRD CQALGINFSR ASFANQITVK SYFCEAHLTG       120
     NNFSYANFEG CLLEQCELSG NRWQGANLFG ASLAGSDLSG SEFGQIDWAS VNLQGCDLRQ       180
     CDLPGLDLRR VNLDGVQINE DQQQALLEQI GLIVFP                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page