(data stored in ACNUC7421 zone)

EMBL: CP000462.PE275

CP000462.PE275       Location/Qualifiers
FT   CDS             323086..323517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0294"
FT                   /product="rhodanese domain protein"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36766"
FT                   /db_xref="GOA:A0KF06"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF06"
FT                   /protein_id="ABK36766.1"
FT                   /translation="MQEYLDFAARNPLLTAAWFGLAGTLVYTTVRARFSPVKSVNNHTA
FT                   TLLINRENATVVDIRSQEEFAKGHLAGAQHLPLSQIQSNNLGPVEKHKDAPIIVVCESG
FT                   MTAGGAGRQLSKAGFKQVYVLSGGMAQWRAENLPVTKKR"
     MQEYLDFAAR NPLLTAAWFG LAGTLVYTTV RARFSPVKSV NNHTATLLIN RENATVVDIR        60
     SQEEFAKGHL AGAQHLPLSQ IQSNNLGPVE KHKDAPIIVV CESGMTAGGA GRQLSKAGFK       120
     QVYVLSGGMA QWRAENLPVT KKR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page