(data stored in ACNUC7421 zone)

EMBL: CP000462.PE277

CP000462.PE277       Location/Qualifiers
FT   CDS             324038..325042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0296"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /EC_number="1.1.1.94"
FT                   /note="identified by match to protein family HMM PF01210;
FT                   match to protein family HMM PF02558; match to protein
FT                   family HMM PF07479"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36018"
FT                   /db_xref="GOA:A0KF08"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0KF08"
FT                   /protein_id="ABK36018.1"
FT                   /translation="MADQIAISVLGAGSYGSALAISLARNGHPTLLWGHDPAHVAELEQ
FT                   DRCNKAFLPDVPFPADLQLTADLQQAVQAAPVLLLVVPSHVFGQVLAQVKPFLRPDTRI
FT                   AWATKGLEPDSGRLLQDVAREVLGDEMPLAVISGPTFAKELAAGLPTAISVASTHDDFA
FT                   DDLSLLLHCGRSFRVYTNPDFIGLQLGGAVKNVIAIGAGLSDGLGFGANARTALITRGL
FT                   VEMQRLGAALGADAKTFMGMAGLGDLVLTCTDNQSRNRRFGLALGAGKDVNTAMAEIGQ
FT                   VVEGYRNTKEVHLLAARCGVEMPICEQIFKVLYEGKNPKEAAIALLSRDKKDE"
     MADQIAISVL GAGSYGSALA ISLARNGHPT LLWGHDPAHV AELEQDRCNK AFLPDVPFPA        60
     DLQLTADLQQ AVQAAPVLLL VVPSHVFGQV LAQVKPFLRP DTRIAWATKG LEPDSGRLLQ       120
     DVAREVLGDE MPLAVISGPT FAKELAAGLP TAISVASTHD DFADDLSLLL HCGRSFRVYT       180
     NPDFIGLQLG GAVKNVIAIG AGLSDGLGFG ANARTALITR GLVEMQRLGA ALGADAKTFM       240
     GMAGLGDLVL TCTDNQSRNR RFGLALGAGK DVNTAMAEIG QVVEGYRNTK EVHLLAARCG       300
     VEMPICEQIF KVLYEGKNPK EAAIALLSRD KKDE                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page