(data stored in ACNUC7421 zone)

EMBL: CP000462.PE282

CP000462.PE282       Location/Qualifiers
FT   CDS             327621..328418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36489"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF13"
FT                   /protein_id="ABK36489.1"
FT                   /translation="MNINVSLPTIIPNQLQPQTESARTDNRRAALIPQSRQSEAFNAES
FT                   EVGSQKEKSRASQANPNQTSQQARDGAQTSNPQAAIDNRFVEAAGEDGQRNKQQDPKQQ
FT                   EQQQKQELQVKELADRDQEVRTHEQAHQSTGGQYAGSPTYEFAMGPDGKRYATGGGVSI
FT                   DIGTIPGDPRATIAKMQQVRAAALAPAEPSSQDLSVARSAAAKEAQARKALLSSDPDTA
FT                   LAADGSAKTGVLNGYMEQRNQVIAQRYQQAVKPAAQQNLNLSV"
     MNINVSLPTI IPNQLQPQTE SARTDNRRAA LIPQSRQSEA FNAESEVGSQ KEKSRASQAN        60
     PNQTSQQARD GAQTSNPQAA IDNRFVEAAG EDGQRNKQQD PKQQEQQQKQ ELQVKELADR       120
     DQEVRTHEQA HQSTGGQYAG SPTYEFAMGP DGKRYATGGG VSIDIGTIPG DPRATIAKMQ       180
     QVRAAALAPA EPSSQDLSVA RSAAAKEAQA RKALLSSDPD TALAADGSAK TGVLNGYMEQ       240
     RNQVIAQRYQ QAVKPAAQQN LNLSV                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page