(data stored in ACNUC7421 zone)

EMBL: CP000462.PE283

CP000462.PE283       Location/Qualifiers
FT   CDS             328514..328792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AHA_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AHA_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ABK36105"
FT                   /db_xref="UniProtKB/TrEMBL:A0KF14"
FT                   /protein_id="ABK36105.1"
FT                   /translation="MHFDEVKPEDFATFSRVPPPHLQMEQFLMQLGGGGTEGTHFKKKV
FT                   MLAAGWSHTGVVSYGKYPQEACKAFNRLREVLAAHREADAILAALAQ"
     MHFDEVKPED FATFSRVPPP HLQMEQFLMQ LGGGGTEGTH FKKKVMLAAG WSHTGVVSYG        60
     KYPQEACKAF NRLREVLAAH READAILAAL AQ                                      92
//

If you have problems or comments...

PBIL Back to PBIL home page